PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRAS
Protein Properties Length: 480aa    MW: 54458 Da    PI: 6.3556
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930860.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.84.3e-93794551373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++ Ll+ A+av++++++ a ++L +l +++s +gdp+qR+aayf+ +Laarl+ ++s  y+++ +++++    +ee+ a++ ++++sP+++f+h
  XP_010930860.1  79 LIHMLLASATAVDANNMSSAINALHELYQHVSTSGDPIQRVAAYFADGLAARLLTKSSPFYQTIMAQPAP----EEEFLAFTELYKASPFYQFAH 169
                     689*************************************************************999998....678888899************ PP

            GRAS  96 ltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlv 182
                     +taNqaI+ea+e+e     + +H+iDfd+s+G+QWp+L+q+L++++  ++p slRiTg+g     s eel+et+ rL +f + + +++++f+ l 
  XP_010930860.1 170 FTANQAIMEAFEEEeehngRSLHVIDFDVSYGFQWPSLIQSLSDKAtrSKPISLRITGIGG----SIEELRETEMRLVNFTKGCdNLQMKFEGL- 259
                     ************9988887889*********************999856666*********....9****************9956*******8. PP

            GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        l     ++++++++ +l+Vnlv+ l++l  +s +    +++vL  + sl+P +v+vve+e      +Fl rf+e+l+yy+a+fdsl+  lp+
  XP_010930860.1 260 ---LRGSARSDFKIEKNATLVVNLVFYLQNLR-SSSE----ISDVLMGLYSLNPSLVIVVEKEGGQRPCTFLSRFMESLHYYAAMFDSLNDCLPA 346
                     ...66777899*******************97.3333....456*************************************************** PP

            GRAS 278 eseerikvErellgreivnvvacegaerrerh...etlekWrerleeaGFkpvplsekaakqaklllr........kvk.sdgyrve.eesgslv 359
                     es er k+E+  lgrei+ + + e++e +e+h   e+l +W+ ++e++GF++++ls++ + qaklll+        +++ ++g+r+   ++g+++
  XP_010930860.1 347 ESTERLKIEKNHLGREIKIAMTEEEKE-EEKHlkfERLDTWKGKMESFGFEEIKLSSRSVGQAKLLLKikshlstiEHDgVRGFRILgRDEGQAI 440
                     ******************999999888.444423388889**************************98333333333444566776554567777 PP

            GRAS 360 .lgWkdrpLvsvSaW 373
                      lgW+dr L++vSaW
  XP_010930860.1 441 sLGWQDRHLTTVSAW 455
                     7************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.19653425IPR005202Transcription factor GRAS
PfamPF035141.5E-9079455IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MQEDTGEEML SLNLGISSTW CSSTTKKRKR RDETNVISCG ALTHDVLERK FFGLLQRRER  60
MLRLDPRRNG LEDGEGLQLI HMLLASATAV DANNMSSAIN ALHELYQHVS TSGDPIQRVA  120
AYFADGLAAR LLTKSSPFYQ TIMAQPAPEE EFLAFTELYK ASPFYQFAHF TANQAIMEAF  180
EEEEEHNGRS LHVIDFDVSY GFQWPSLIQS LSDKATRSKP ISLRITGIGG SIEELRETEM  240
RLVNFTKGCD NLQMKFEGLL RGSARSDFKI EKNATLVVNL VFYLQNLRSS SEISDVLMGL  300
YSLNPSLVIV VEKEGGQRPC TFLSRFMESL HYYAAMFDSL NDCLPAESTE RLKIEKNHLG  360
REIKIAMTEE EKEEEKHLKF ERLDTWKGKM ESFGFEEIKL SSRSVGQAKL LLKIKSHLST  420
IEHDGVRGFR ILGRDEGQAI SLGWQDRHLT TVSAWHCVRS PITHLDAVCS WPNVSSLRLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-44844568375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12530KKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930860.10.0PREDICTED: scarecrow-like protein 21
TrEMBLM5VGL50.0M5VGL5_PRUPE; Uncharacterized protein
STRINGGSMUA_Achr6P17870_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116493038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-51RGA-like 2